PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00338.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 127aa    MW: 14819.2 Da    PI: 10.0785
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00338.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.45.2e-251058250
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                  rien   rqvtf+kRr g+lKKA ELS+LCda++ vi+fs++gk+ye +
  Zmw_sc00338.1.g00040.1.sm.mk 10 RIENPVHRQVTFCKRRMGMLKKARELSILCDADIGVIVFSPNGKIYELA 58
                                  8*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.058161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.76E-28177IPR002100Transcription factor, MADS-box
CDDcd002659.31E-35273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGMLK KARELSILCD ADIGVIVFSP NGKIYELATN  60
GNMQGLIERY RSTYTEKQGE SSEQDKSQFR IQIMYKEIEM LRSKEGILKA SNDILQERYQ  120
LGLSEIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A6e-15385282Myocyte-specific enhancer factor 2A
3kov_B6e-15385282Myocyte-specific enhancer factor 2A
3kov_I6e-15385282Myocyte-specific enhancer factor 2A
3kov_J6e-15385282Myocyte-specific enhancer factor 2A
3p57_A6e-15385282Myocyte-specific enhancer factor 2A
3p57_B6e-15385282Myocyte-specific enhancer factor 2A
3p57_C6e-15385282Myocyte-specific enhancer factor 2A
3p57_D6e-15385282Myocyte-specific enhancer factor 2A
3p57_I6e-15385282Myocyte-specific enhancer factor 2A
3p57_J6e-15385282Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975710.15e-54PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK97e-44MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G87e-44MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0E0P9M72e-62A0A0E0P9M7_ORYRU; Uncharacterized protein
STRINGOB04G21020.13e-56(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112